Anti-ARHGEF3 antibody (ab224148)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ARHGEF3 antibody
See all ARHGEF3 primary antibodies -
Description
Rabbit polyclonal to ARHGEF3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey, Orangutan -
Immunogen
Recombinant fragment corresponding to Human ARHGEF3 aa 427-497.
Sequence:HSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRE LQGETKLEQMDQSDSESDCSM
Database link: Q9NR81-1 -
Positive control
- WB: RT4 and U-251 MG cell lysates. IHC-P: Human rectum tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab224148 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | 1/100 - 1/250. Predicted molecular weight: 37,60,61,64 kDa. |
Target
-
Relevance
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. ARHGEF3 encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in ARHGEF3 plays a role in the determination of bone mineral density (BMD), suggesting a role in postmenopausal osteoporosis. -
Cellular localization
Cytoplasmic -
Database links
- Entrez Gene: 50650 Human
- Omim: 612115 Human
- SwissProt: Q9NR81 Human
- Unigene: 476402 Human
-
Alternative names
- 1200004I24Rik antibody
- 59.8 kDA protein antibody
- 9830169H03Rik antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ARHGEF3 antibody (ab224148)
Paraffin-embedded human rectum tissue stained for ARHGEF3 using ab224148 at 1/500 dilution in immunohistochemical analysis.
-
All lanes : Anti-ARHGEF3 antibody (ab224148) at 1/100 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Developed using the ECL technique.
Predicted band size: 37,60,61,64 kDa
Datasheets and documents
References
ab224148 has not yet been referenced specifically in any publications.