Anti-ARHGEF3 antibody (ab224148)
Key features and details
- Rabbit polyclonal to ARHGEF3
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ARHGEF3 antibody
See all ARHGEF3 primary antibodies -
Description
Rabbit polyclonal to ARHGEF3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human ARHGEF3 aa 427-497.
Sequence:HSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRE LQGETKLEQMDQSDSESDCSM
Database link: Q9NR81-1 -
Positive control
- WB: RT4 and U-251 MG cell lysates. IHC-P: Human rectum tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224148 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 37,60,61,64 kDa. |
Target
-
Relevance
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. ARHGEF3 encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in ARHGEF3 plays a role in the determination of bone mineral density (BMD), suggesting a role in postmenopausal osteoporosis. -
Cellular localization
Cytoplasmic -
Database links
- Entrez Gene: 50650 Human
- Omim: 612115 Human
- SwissProt: Q9NR81 Human
- Unigene: 476402 Human
-
Alternative names
- 1200004I24Rik antibody
- 59.8 kDA protein antibody
- 9830169H03Rik antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ARHGEF3 antibody (ab224148)Paraffin-embedded human rectum tissue stained for ARHGEF3 using ab224148 at 1/500 dilution in immunohistochemical analysis.
-
Western blot - Anti-ARHGEF3 antibody (ab224148)All lanes : Anti-ARHGEF3 antibody (ab224148) at 1/100 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Developed using the ECL technique.
Predicted band size: 37,60,61,64 kDa
Protocols
Datasheets and documents
References (0)
ab224148 has not yet been referenced specifically in any publications.
