Overview

  • Product name

  • Description

    Rabbit polyclonal to ARHGEF3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ARHGEF3 aa 427-497.
    Sequence:

    HSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRE LQGETKLEQMDQSDSESDCSM


    Database link: Q9NR81-1

  • Positive control

    • WB: RT4 and U-251 MG cell lysates. IHC-P: Human rectum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 37,60,61,64 kDa.

Target

  • Relevance

    Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. ARHGEF3 encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in ARHGEF3 plays a role in the determination of bone mineral density (BMD), suggesting a role in postmenopausal osteoporosis.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • 1200004I24Rik antibody
    • 59.8 kDA protein antibody
    • 9830169H03Rik antibody
    • ARHGEF 3 antibody
    • C76747 antibody
    • DKFZP434F2429 antibody
    • Exchange factor found in platelets and leukemic and neuronal tissues antibody
    • Exchange factor found in platelets and leukemic and neuronal tissues XPLN antibody
    • FLJ98126 antibody
    • GEF 3 antibody
    • GEF3 antibody
    • MGC118905 antibody
    • Rho guanine nucleotide exchange factor (GEF) 3 antibody
    • Rho guanine nucleotide exchange factor 3 antibody
    • RhoGEF protein antibody
    • STA 3 antibody
    • STA3 antibody
    • XPLN antibody
    see all

Images

  • Paraffin-embedded human rectum tissue stained for ARHGEF3 using ab224148 at 1/500 dilution in immunohistochemical analysis.

  • All lanes : Anti-ARHGEF3 antibody (ab224148) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 37,60,61,64 kDa

References

ab224148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up