Overview

  • Product name

  • Description

    Rabbit polyclonal to ARHI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ARHI aa 1-68.
    Sequence:

    MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGK STLLHKWASGNFRHEYLP


    Database link: O95661

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab246963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Tissue specificity

    Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Di-Ras family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DIRA3 antibody
    • DIRA3_HUMAN antibody
    • DIRAS family GTP binding RAS like 3 antibody
    • DIRAS family GTPase 3 antibody
    • DIRAS family, GTP-binding RAS-like protein 3 antibody
    • DIRAS3 antibody
    • Distinct subgroup of the Ras family member 3 antibody
    • GTP binding protein Di Ras3 antibody
    • GTP-binding protein Di-Ras3 antibody
    • NOEY2 antibody
    • Ras homolog gene family member I antibody
    • Rho related GTP binding protein RhoI antibody
    • Rho-related GTP-binding protein RhoI antibody
    • RHOI antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for ARHI (green) using ab246963 at 4 μg/ml in ICC/IF.

  • Paraffin-embedded human testis tissue stained for ARHI using ab246963 at 1/50 dilution in immunohistochemical analysis.

References

ab246963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up