Overview

  • Product name

    Anti-ARIH2/TRIAD1 antibody
    See all ARIH2/TRIAD1 primary antibodies
  • Description

    Rabbit polyclonal to ARIH2/TRIAD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ARIH2/TRIAD1 aa 43-360.
    Sequence:

    ASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAK LILVNFHWQVSEILDRYKSNSAQLLVEARVQPNPSKHVPTSHPPHHCAVC MQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRT PEDFVFPLLPNEELREKYRRYLFRDYVESHYQLQLCPGADCPMVIRVQEP RARRVQCNRCNEVFCFKCRQMYHAPTDCATIRKWLTKCADDSETANYISA HTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSR YKENPDIVNQSQQAQARE


    Database link: O95376

  • Positive control

    • WB: HEK-293, HeLa and Jurkat whole cell lysates; Mouse heart, liver and brain lysates. IHC-P: Human lymph node tissue.
  • General notes

     This product was previously labelled as ARIH2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/5000. Predicted molecular weight: 57 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. May play a role in myelopoiesis.
  • Tissue specificity

    Widely expressed with higher expression in granulocytes.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the RBR family. Ariadne subfamily.
    Contains 1 IBR-type zinc finger.
    Contains 2 RING-type zinc fingers.
  • Domain

    RING-type 1 and RING-type 2 are required for the inhibitory function in myelopoiesis.
  • Post-translational
    modifications

    Ubiquitinated. Ubiquitination promotes proteasomal degradation.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • HT005 antibody
    • all trans retinoic acid inducible RING finger antibody
    • Ari 2 antibody
    • Ari-2 antibody
    • ARI2 antibody
    • ARI2_HUMAN antibody
    • Ariadne 2 antibody
    • Ariadne 2 protein homolog antibody
    • ariadne homolog 2 (Drosophila) antibody
    • ariadne homolog 2 antibody
    • Ariadne RBR E3 ubiquitin protein ligase 2 antibody
    • ARIH 2 antibody
    • Arih2 antibody
    • E3 ubiquitin protein ligase ARIH2 antibody
    • E3 ubiquitin-protein ligase ARIH2 antibody
    • protein ariadne 2 homolog antibody
    • Protein ariadne-2 homolog antibody
    • Triad 1 antibody
    • TRIAD1 antibody
    • Triad1 protein antibody
    • UIP48 antibody
    see all

Images

  • All lanes : Anti-ARIH2/TRIAD1 antibody (ab222813) at 1/2000 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 4 : Mouse heart lysate
    Lane 5 : Mouse liver lysate
    Lane 6 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 57 kDa
    Observed band size: 58 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human lymph node tissue stained for ARIH2/TRIAD1 using ab222813 at 1/100 dilution in immunohistochemical analysis.

References

ab222813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up