Overview

  • Product name

  • Description

    Rabbit polyclonal to ARIP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ARIP4 aa 1285-1379.
    Sequence:

    EHGYPVSGGFAMPPVSLNHNLTTPFTSQAGENSLFMGSTPSYYQLSNLLA DARLVFPVTTDPLVPAGPVSSSSTATSVTASNPSFMLNPSVPGIL


    Database link: Q9Y4B4

  • Positive control

    • U-2 OS cells.
  • General notes

    Previously labelled as RAD54L2.

Properties

Applications

Our Abpromise guarantee covers the use of ab220238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    DNA helicase that modulates androgen receptor (AR)-dependent transactivation in a promoter-dependent manner. Not able to remodel mononucleosomes in vitro.
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Domain

    Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs are known to be important for the association with nuclear receptors.
  • Post-translational
    modifications

    Sumoylated.
  • Cellular localization

    Nucleus. Localizes in speckle-like nuclear compartments.
  • Information by UniProt
  • Database links

  • Alternative names

    • Androgen receptor interacting protein 4 antibody
    • Androgen receptor-interacting protein 4 antibody
    • Arip4 antibody
    • ARIP4_HUMAN antibody
    • HCMV interacting protein; antibody
    • Helicase ARIP4 antibody
    • HSPC325 antibody
    • RAD54 like 2 (S. cerevisiae) antibody
    • RAD54 like protein 2 antibody
    • RAD54-like protein 2 antibody
    • Rad54l2 antibody
    • SRISNF2L antibody
    • Steroid receptor interacting SNF2 domain protein antibody
    see all

Images

  • Immunofluorescent analysis of U-2 OS cells (PFA-fixed/Triton X-100 permeabilized) labeling ARIP4 with ab220238 at 4μg/ml (green).

References

ab220238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up