Anti-ARL4D antibody (ab169925)
Key features and details
- Rabbit polyclonal to ARL4D
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-ARL4D antibody -
Description
Rabbit polyclonal to ARL4D -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Cow, Orangutan -
Immunogen
Recombinant full length protein corresponding to Human ARL4D.
Sequence:GNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVP TKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVV DAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKR LAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKR
Database link: P49703 -
Positive control
- B16 (mouse melanoma) cell lysate and Human fetal kidney tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 1% BSA, 98% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab169925 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/100 - 1/500.
|
|
WB |
1/500 - 1/1000. Predicted molecular weight: 22 kDa.
|
Notes |
---|
IHC-P
1/100 - 1/500. |
WB
1/500 - 1/1000. Predicted molecular weight: 22 kDa. |
Target
-
Function
Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form. -
Sequence similarities
Belongs to the small GTPase superfamily. Arf family. -
Cellular localization
Nucleus > nucleolus. Cell membrane. Nucleus. Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 538936 Cow
- Entrez Gene: 379 Human
- Entrez Gene: 80981 Mouse
- Entrez Gene: 100171631 Orangutan
- Entrez Gene: 303559 Rat
- Omim: 600732 Human
- SwissProt: Q0VC18 Cow
- SwissProt: P49703 Human
see all -
Alternative names
- ADP ribosylation factor 4 like antibody
- ADP ribosylation factor like 4D antibody
- ADP ribosylation factor like 6 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab169925 has not yet been referenced specifically in any publications.