Overview

  • Product name

  • Description

    Rabbit polyclonal to ARL8B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ARL8B aa 30-181. (BC013131).
    Sequence:

    YSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFR SMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLG NKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQ HS


    Database link: Q9NVJ2

  • Positive control

    • Jurkat cell lysate; Human oviduct tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab207697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Detects a band of approximately 15 kDa (predicted molecular weight: 21 kDa).
IHC-P 1/100 - 1/500.

Target

Images

  • Anti-ARL8B antibody (ab207697) at 1/1000 dilution + Jurkat cell lysate

    Predicted band size: 21 kDa
    Observed band size: 15 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human oviduct tissue labeling ARL8B with ab207697 at 1/100 dilution.

References

ab207697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up