Overview

  • Product name

  • Description

    Rabbit polyclonal to ARMCX3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ARMCX3 aa 253-373.
    Sequence:

    SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVI LKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIES HHDFLVKVKVGKFMAKLAEHM


    Database link: Q9UH62

  • Positive control

    • IHC: Human stomach tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    ARMCX3 belongs to the ALEX family of proteins and contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other members of the ALEX family are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is localized won the X chromosome andtThree transcript variants have been identified.
  • Cellular localization

    Membrane; Single-pass membrane protein
  • Database links

  • Alternative names

    • 1200004E24Rik antibody
    • ALEX3 antibody
    • ARM protein lost in epithelial cancers on chromosome X 3 antibody
    • Arm protein lost in epithelial cancers, X chromosome, 3 antibody
    • Armadillo repeat containing X linked protein 3 antibody
    • dJ545K15.2 antibody
    • DKFZp781N1954 antibody
    • KIAA0443 antibody
    • MGC12199 antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for ARMCX3 using ab224039 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human brain glioma cell line) cells stained for ARMCX3 (green) using ab224039 at 4 µg/ml in ICC/IF.

References

ab224039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up