Overview

  • Product name

  • Description

    Rabbit polyclonal to ARP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ARP1 aa 24-289.
    Sequence:

    GQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDA STIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKES RNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYR ELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHI PNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFIN EGPFKDCQQAKEAGHS


    Database link: O95841

  • Positive control

    • IHC-P: Human kidney and testis tissues.
  • General notes

     This product was previously labelled as ANGPTL1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Highly expressed in adrenal gland, placenta, thyroid gland, heart, skeletal muscle and small intestine. Weakly expressed in testis, ovary, colon, pancreas, kidney and stomach.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANG 3 antibody
    • ANG-3 antibody
    • ANG3 antibody
    • Angioarrestin antibody
    • Angiopoietin 3 antibody
    • Angiopoietin like 1 antibody
    • Angiopoietin like protein 1 antibody
    • Angiopoietin related protein 1 antibody
    • Angiopoietin Y1 antibody
    • Angiopoietin-3 antibody
    • Angiopoietin-like protein 1 antibody
    • Angiopoietin-related protein 1 antibody
    • ANGL1_HUMAN antibody
    • ANGPT3 antibody
    • ANGPTL1 antibody
    • AngY antibody
    • ARP1 antibody
    • dJ595C2.2 antibody
    • KIAA0351 antibody
    • UNQ162 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for ARP1 using ab222812 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for ARP1 using ab222812 at 1/100 dilution in immunohistochemical analysis.

References

ab222812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up