Overview

  • Product name

  • Description

    Rabbit polyclonal to ARP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human ARP1 aa 187-376.
    Sequence:

    GRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLET EKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKS DMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQER LYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF


    Database link: P61163

  • Positive control

    • WB: MCF7 cell lysate. IHC: Human ovarian cancer and pancreatic cancer tissue.
  • General notes

    Previously labelled as ACTR1A.

Properties

Applications

Our Abpromise guarantee covers the use of ab224598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 43 kDa (predicted molecular weight: 43 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human ovarian cancer tissue stained for ARP1 using ab224598 at 1/100 dilution in immunohistochemical analysis.

  • Anti-ARP1 antibody (ab224598) at 1/500 dilution + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa
    Observed band size: 43 kDa

  • Paraffin-embedded human pancreatic cancer tissue stained for ARP1 using ab224598 at 1/100 dilution in immunohistochemical analysis.

References

ab224598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up