Overview

  • Product name
  • Description
    Rabbit polyclonal to ARP19
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human ARP19 aa 1-31.
    Sequence:

    MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK


    Database link: P56211

  • Positive control
    • Human placenta tissue, adrenal gland tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab188615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin embedded Human adrenal gland tissue staining ARP19 using ab188615 at a 1/200 dilution.

  • Immunohistochemical analysis of paraffin embedded Human placenta tissue staining ARP19 using ab188615 at a 1/200 dilution

References

ab188615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up