Overview

  • Product name
  • Description
    Rabbit polyclonal to Arp3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human, African green monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Arp3 aa 1-418.
    Sequence:

    MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRR VMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKY LRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALA ASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDI TYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGS KWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLS EELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDY EEIGPSICRHNPVFGVMS


    Database link: P61158

  • Positive control
    • K562, HL60, HeLa, Jurkat, Cos1, Cos7, mouse spleen and mouse liver lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab175307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 47 kDa.

Target

  • Relevance
    The Arp2/3 complex involved in Golgi polerization in NIH3T3 cells. In a different model it has been shown that the Arp2/3 complex is necessary for neutrophil chemotaxis and phagocytosis.
  • Cellular localization
    Cytoplasmic
  • Database links
  • Alternative names
    • Actin like protein 3 antibody
    • Actin related protein 3 antibody
    • ACTR3 antibody
    • ARP3 actin related protein 3 homolog (yeast) antibody

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling Arp3 with ab175307 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling Arp3 with ab175307 at 1/200. Magnification: 400x.
  • All lanes : Anti-Arp3 antibody (ab175307) at 1/500 dilution

    Lane 1 : K562 cell lysate
    Lane 2 : HL60 cell lysate
    Lane 3 : HeLa cell lysate
    Lane 4 : Jurkat cell lysate
    Lane 5 : Cos1 cell lysate
    Lane 6 : Cos7 cell lysate
    Lane 7 : mouse spleen lysate
    Lane 8 : mouse liver lysate

    Predicted band size: 47 kDa

References

ab175307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up