Overview

  • Product name

  • Description

    Rabbit polyclonal to Arp3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pufferfish, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Arp3 aa 352-409.
    Sequence:

    ELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYE EIGPSICR


    Database link: P61158

  • Positive control

    • IHC-P: Human placenta tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human placenta tissue stained for Arp3 using ab236102 at 1/100 dilution in immunohistochemical analysis. 

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling Arp3 using ab236102 at 1/100 in ICC/IF, followed by an Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

References

ab236102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up