Overview

  • Product name

  • Description

    Rabbit polyclonal to Arpin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human Arpin aa 1-226.
    Sequence:

    MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSIL DTHGRKERYYVLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSY KVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEMEVM ELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIM AQKCSKGAAAEIREQGDGAEDEEWDD


    Database link: Q7Z6K5

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human colon cancer and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 25 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-Arpin antibody (ab235421) at 1/1000 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 25 kDa

  • Paraffin-embedded human colon cancer tissue stained for Arpin using ab235421 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Arpin using ab235421 at 1/100 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Zhang SR  et al. Arpin downregulation is associated with poor prognosis in pancreatic ductal adenocarcinoma. Eur J Surg Oncol 45:769-775 (2019). Read more (PubMed: 30416079) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up