Overview

  • Product name

  • Description

    Rabbit polyclonal to ARPP-19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human ARPP-19 aa 2-105.
    Sequence:

    SAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRK RLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQR KPSL


    Database link: P56211-1

  • Positive control

    • IHC-P: Human placenta tissue. ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as ARP19.

Properties

Applications

Our Abpromise guarantee covers the use of ab234732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human placenta tissue stained for ARPP-19 with ab234732 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ARPP-19 using ab234732 at a dilution of 1/100 in ICC/IF. Secondary antibody is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up