Overview

  • Product name

    Anti-Arrestin C antibody - C-terminal
    See all Arrestin C primary antibodies
  • Description

    Rabbit polyclonal to Arrestin C - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Arrestin C aa 339-388 (C terminal). The exact sequence is proprietary. NP_004303.2.
    Sequence:

    DVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS


    Database link: P36575

  • Positive control

    • Human eye, retina tissue; LOVO cell extracts.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol

    PBS (without Mg2+, Ca2+)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 43 kDa.
IHC-P Use a concentration of 20 µg/ml.

Target

  • Function

    May play a role in an as yet undefined retina-specific signal transduction. Could binds to photoactivated-phosphorylated red/green opsins.
  • Tissue specificity

    Inner and outer segments, and the inner plexiform regions of the retina.
  • Sequence similarities

    Belongs to the arrestin family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARR3 antibody
    • ARR4 antibody
    • ARRC_HUMAN antibody
    • Arrestin 3 retinal antibody
    • Arrestin 3 retinal (X-arrestin) antibody
    • Arrestin 4 antibody
    • Arrestin-C antibody
    • ARRX antibody
    • C arrestin antibody
    • C-arrestin antibody
    • CAR antibody
    • cArr antibody
    • Cone arrestin antibody
    • Retinal cone arrestin 3 antibody
    • Retinal cone arrestin-3 antibody
    • X arrestin antibody
    • X-arrestin antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human eye, retina tissue labeling Arrestin C with ab189437 at 20 µg/ml.

  • All lanes : Anti-Arrestin C antibody - C-terminal (ab189437) at 1/500 dilution

    Lane 1 : LOVO cell extract
    Lane 2 : LOVO cell extract with immunizing peptide

    Predicted band size: 43 kDa

References

ab189437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up