Overview

  • Product name

    Anti-ARS2 antibody - C-terminal
    See all ARS2 primary antibodies
  • Description

    Rabbit polyclonal to ARS2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Chinese hamster, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ARS2 aa 780-876 (C terminal).
    Sequence:

    GLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPY GAGRGNYDAFRGQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF


    Database link: Q9BXP5

  • Positive control

    • RT-4 and U-251 MG cell lysates; MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 101 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Acts as a mediator between the cap-binding complex (CBC) and the primary microRNAs (miRNAs) processing machinery during cell proliferation. Contributes to the stability and delivery of capped primary miRNA transcripts to the primary miRNA processing complex containing DGCR8 and DROSHA, thereby playing a role in RNA-mediated gene silencing (RNAi) by miRNAs. Binds capped RNAs (m7GpppG-capped RNA); however interaction is probably mediated via its interaction with NCBP1/CBP80 component of the CBC complex. Involved in cell cycle progression at S phase. Does not directly confer arsenite resistance but rather modulates arsenic sensitivity.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the ARS2 family.
  • Cellular localization

    Nucleus > nucleoplasm. Cytoplasm. Predominantly nuclear. Shuttles between the nucleus and the cytoplasm in a CRM1-dependent way.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARS2 protein antibody
    • Arsenate resistance protein ARS2 antibody
    • Arsenite resistance protein 2 antibody
    • Arsenite resistance protein antibody
    • Arsenite-resistance protein 2 antibody
    • ASR2 antibody
    • MGC126427 antibody
    • Serrate antibody
    • Serrate RNA effector molecule antibody
    • Serrate RNA effector molecule homolog (Arabidopsis) antibody
    • Serrate RNA effector molecule homolog antibody
    • SRRT antibody
    • SRRT_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling ARS2 with ab220991 at 4 μg/ml (green). 

  • All lanes : Anti-ARS2 antibody - C-terminal (ab220991) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 101 kDa

References

ab220991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up