Anti-ARSE/ASE antibody (ab238485)
Key features and details
- Rabbit polyclonal to ARSE/ASE
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ARSE/ASE antibody
See all ARSE/ASE primary antibodies -
Description
Rabbit polyclonal to ARSE/ASE -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human ARSE/ASE aa 352-494.
Sequence:SDHGGSLENQLGNTQYGGWNGIYKGGKGMGGWEGGIRVPGIFRWPGVLPA GRVIGEPTSLMDVFPTVVRLAGGEVPQDRVIDGQDLLPLLLGTAQHSDHE FLMHYCERFLHAARWHQRDRGTMWKVHFVTPVFQPEGAGACYG
Database link: P51690 -
Positive control
- IHC-P: Human liver and pancreatic tissues. ICC/IF: HepG2 cells.
-
General notes
Previously labelled as ARSE
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab238485 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Relevance
Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. -
Cellular localization
Golgi apparatus, Golgi stack. -
Database links
- Entrez Gene: 415 Human
- Omim: 300180 Human
- SwissProt: P51690 Human
-
Alternative names
- ARSE antibody
- Arylsulfatase E (chondrodysplasia punctata 1) antibody
- Arylsulfatase E antibody
see all
Images
-
4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for ARSE/ASE (green) using ab238485 at 1/133 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI.
The cells were blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ARSE/ASE antibody (ab238485)
Paraffin-embedded human liver tissue stained for ARSE/ASE using ab238485 at 1/400 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ARSE/ASE antibody (ab238485)
Paraffin-embedded human pancreatic tissue stained for ARSE/ASE using ab238485 at 1/400 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab238485 has not yet been referenced specifically in any publications.