Overview

  • Product name

    Anti-ARSK antibody
  • Description

    Rabbit polyclonal to ARSK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Recombinant fragment corresponding to Human ARSK aa 244-392.
    Sequence:

    WSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYYAMCAETDAMLGEI ILALHQLDLLQKTIVIYSSDHGELAMEHRQFYKMSMYEASAHVPLLMMGP GIKAGLQVSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLPLSSETFKNE


    Database link: Q6UWY0

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Sequence similarities

    Belongs to the sulfatase family.
  • Post-translational
    modifications

    The conversion to 3-oxoalanine (also known as C-formylglycine, FGly), of a serine or cysteine residue in prokaryotes and of a cysteine residue in eukaryotes, is critical for catalytic activity.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • arsk antibody
    • ARSK_HUMAN antibody
    • arylsulfatase family member K antibody
    • Arylsulfatase K antibody
    • Arylsulfatase K precursor antibody
    • ASK antibody
    • DKFZp313G1735 antibody
    • OTTHUMP00000149978 antibody
    • Telethon sulfatase antibody
    • TSULF antibody
    see all

Images

  • Paraformaldehyde-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for ARSK (Green) using ab243501 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human kidney tissue stained for ARSK using ab243501 at 1/50 dilution in immunohistochemical analysis.

References

ab243501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up