Overview

  • Product name

    Anti-AS160 antibody [8A11A2]
    See all AS160 primary antibodies
  • Description

    Mouse monoclonal [8A11A2] to AS160
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AS160 aa 574-712. (Expressed in E.coli).
    Sequence:

    IFSRGANRMRGRLGSVDSFERSNSLASEKDYSPGDSPPGTPPASPPSSAW QTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQDGRAQGVRSPLLRQSS SEQCSNLSSVRRMYKESNSSSSLPSLHTSFSAPSFTAPS


    Database link: O60343

  • Positive control

    • WB: Recombinant human AS160 (AA: 574-712) protein and AS160 (AA: 574-712)-hIgGFc transfected HEK-293 whole cell lysate. FC: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    8A11A2
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    May act as a GTPase-activating protein for RAB2A, RAB8A, RAB10 and RAB14. Isoform 2 promotes insulin-induced glucose transporter SLC2A4/GLUT4 translocation at the plasma membrane, thus increasing glucose uptake.
  • Tissue specificity

    Widely expressed. Isoform 2 is the highest overexpressed in most tissues. Isoform 1 is highly expressed in skeletal muscle and heart, but was not detectable in the liver nor in adipose tissue. Isoform 2 is strongly expressed in adrenal and thyroid gland, and also in lung, kidney, colon, brain and adipose tissue. Isoform 2 is moderately expressed in skeletal muscle. Expressed in pancreatic Langerhans islets, including beta cells (at protein level). Expression is decreased by twofold in pancreatic islets in type 2 diabetes patients compared to control subjects. Up-regulated in T cells from patients with atopic dermatitis.
  • Sequence similarities

    Contains 2 PID domains.
    Contains 1 Rab-GAP TBC domain.
  • Post-translational
    modifications

    Phosphorylated by AKT1; insulin-induced.
    Insulin-stimulated phosphorylation is required for SLC2A4/GLUT4 translocation.
    Physiological hyperinsulinemia increases phosphorylation in skeletal muscle. Insulin-stimulated phosphorylation is reduced by 39% in type 2 diabetic patients.
  • Cellular localization

    Cytoplasm. Isoform 2 shows a cytoplasmic perinuclear localization in a myoblastic cell line in resting and insulin-stimulated cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acrg embryonic lethality (mouse) minimal region ortholog antibody
    • Acrg embryonic lethality minimal region ortholog antibody
    • Acrg embryonic lethality mouse minimal region ortholog antibody
    • Akt substrate of 160 kDa antibody
    • AS 160 antibody
    • AS160 antibody
    • BUB2 antibody
    • CDC16 antibody
    • KIAA0603 antibody
    • NIDDM5 antibody
    • TBC (Tre 2 BUB2 CDC16) domain containing protein antibody
    • TBC Tre 2 BUB2 CDC16 domain containing protein antibody
    • TBC1 D4 antibody
    • TBC1 domain family member 4 antibody
    • Tbc1d4 antibody
    • TBCD4_HUMAN antibody
    • Tre-2 antibody
    see all

Images

  • Anti-AS160 antibody [8A11A2] (ab233784) at 1/500 dilution + Recombinant human AS160 (AA: 574-712) protein

    Developed using the ECL technique.


    Expected MW is 41.2 kDa.

  • All lanes : Anti-AS160 antibody [8A11A2] (ab233784) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : AS160 (AA: 574-712)-hIgGFc transfected HEK-293 whole cell lysate

    Developed using the ECL technique.
  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cell line labeling AS160 with ab233784 at 1/200 dilution (green) compared with a negative control (red).

References

ab233784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up