Anti-ASAP1 / DDEF1 antibody (ab208170)
Key features and details
- Rabbit polyclonal to ASAP1 / DDEF1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ASAP1 / DDEF1 antibody
See all ASAP1 / DDEF1 primary antibodies -
Description
Rabbit polyclonal to ASAP1 / DDEF1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow
-
Immunogen
Recombinant fragment corresponding to Human ASAP1/ DDEF1 aa 912-1115.
Sequence:DKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPGE LPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKA QQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRK INTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEG QPER
Database link: Q9ULH1 -
Positive control
- Pancreas lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 99% PBS, 0.05% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab208170 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 4 µg/ml. Predicted molecular weight: 125 kDa. |
Target
-
Function
Possesses phosphatidylinositol 4,5-biphosphate-dependent GTPase-activating protein activity for ARF1 (ADP ribosylation factor 1) and ARF5 and a lesser activity towards ARF6. May coordinate membrane trafficking with cell growth or actin cytoskeleton remodeling by binding to both SRC and PIP2. May function as a signal transduction protein involved in the differentiation of fibroblasts into adipocytes and possibly other cell types (By similarity). Plays a role in ciliogenesis. -
Sequence similarities
Contains 2 ANK repeats.
Contains 1 Arf-GAP domain.
Contains 1 PH domain.
Contains 1 SH3 domain. -
Domain
The PH domain most probably contributes to the phosphoinositide-dependent regulation of ADP ribosylation factors. -
Post-translational
modificationsPhosphorylated on tyrosine residues by SRC. -
Cellular localization
Cytoplasm. Membrane. Predominantly cytoplasmic (By similarity). Partially membrane-associated. - Information by UniProt
-
Database links
- Entrez Gene: 327705 Cow
- Entrez Gene: 50807 Human
- Entrez Gene: 314961 Rat
- Omim: 605953 Human
- SwissProt: O97902 Cow
- SwissProt: Q9ULH1 Human
- SwissProt: Q9QWY8 Mouse
- SwissProt: Q1AAU6 Rat
see all -
Alternative names
- 130 kDa phosphatidylinositol 4 5 biphosphate dependent ARF1 GTPase activating protein antibody
- 130 kDa phosphatidylinositol 4 antibody
- 5-biphosphate-dependent ARF1 GTPase-activating protein antibody
see all
Images
-
Western blot - Anti-ASAP1 / DDEF1 antibody (ab208170)Anti-ASAP1 / DDEF1 antibody (ab208170) at 4 µg/ml + Pancreas lysate
Predicted band size: 125 kDa
Datasheets and documents
References (0)
ab208170 has not yet been referenced specifically in any publications.
