Overview

  • Product name

    Anti-ASAP1 / DDEF1 antibody
    See all ASAP1 / DDEF1 primary antibodies
  • Description

    Rabbit polyclonal to ASAP1 / DDEF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ASAP1/ DDEF1 aa 912-1115.
    Sequence:

    DKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPGE LPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKA QQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRK INTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEG QPER


    Database link: Q9ULH1

  • Positive control

    • Pancreas lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab208170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 4 µg/ml. Predicted molecular weight: 125 kDa.

Target

  • Function

    Possesses phosphatidylinositol 4,5-biphosphate-dependent GTPase-activating protein activity for ARF1 (ADP ribosylation factor 1) and ARF5 and a lesser activity towards ARF6. May coordinate membrane trafficking with cell growth or actin cytoskeleton remodeling by binding to both SRC and PIP2. May function as a signal transduction protein involved in the differentiation of fibroblasts into adipocytes and possibly other cell types (By similarity). Plays a role in ciliogenesis.
  • Sequence similarities

    Contains 2 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Domain

    The PH domain most probably contributes to the phosphoinositide-dependent regulation of ADP ribosylation factors.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues by SRC.
  • Cellular localization

    Cytoplasm. Membrane. Predominantly cytoplasmic (By similarity). Partially membrane-associated.
  • Information by UniProt
  • Database links

  • Alternative names

    • 130 kDa phosphatidylinositol 4 5 biphosphate dependent ARF1 GTPase activating protein antibody
    • 130 kDa phosphatidylinositol 4 antibody
    • 5-biphosphate-dependent ARF1 GTPase-activating protein antibody
    • ADP ribosylation factor directed GTPase activating protein 1 antibody
    • ADP-ribosylation factor-directed GTPase-activating protein 1 antibody
    • AMAP 1 antibody
    • AMAP1 antibody
    • ANK repeat and PH domain-containing protein 1 antibody
    • ARF GTPase activating protein 1 antibody
    • ARF GTPase-activating protein 1 antibody
    • Arf-GAP with SH3 domain antibody
    • ASAP 1 antibody
    • ASAP1 antibody
    • ASAP1_HUMAN antibody
    • Centaurin beta 4 antibody
    • CentB4 antibody
    • DDEF 1 antibody
    • DDEF1 protein antibody
    • DEF-1 antibody
    • Development and differentiation enhancing factor 1 antibody
    • Development and differentiation-enhancing factor 1 antibody
    • Differentiation-enhancing factor 1 antibody
    • KIAA1249 antibody
    • PAG 2 antibody
    • PAG2 antibody
    • PAP antibody
    • PIP2 dependent ARF1 GAP antibody
    • PIP2-dependent ARF1 GAP antibody
    • ZG 14P antibody
    • ZG14P antibody
    see all

Images

  • Anti-ASAP1 / DDEF1 antibody (ab208170) at 4 µg/ml + Pancreas lysate

    Predicted band size: 125 kDa

References

ab208170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up