Overview

  • Product name

  • Description

    Rabbit polyclonal to ASC-2/NRC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ASC-2/NRC aa 285-504.
    Sequence:

    QLQARPPQQHQQQQPQGIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGS LGTMTANQGWKKAPLPGPMQQQLQARPSLATVQTPSHPPPPYPFGSQQAS QAHTNFPQMSNPGQFTAPQMKSLQGGPSRVPTPLQQPHLTNKSPASSPSS FQQGSPASSPTVNQTQQQMGPRPPQNNPLPQGFQQPVSSPGRNPMVQQGN VPPNFMVMQQQPPNQGPQSL


    Database link: Q14686

  • Positive control

    • IHC-P: Human colon cancer tissue.
  • General notes

     This product was previously labelled as ASC-2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab238848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    The protein encoded by this gene is a nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone dependent fashion. It is involved in the coactivation of different nuclear receptors, such as steroids (GR and ERs), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). It probably functions as a general coactivator, rather than just a nuclear receptor coactivator,and may also be involved in the coactivation of the NFkB pathway (referenced from swissprot).
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Activating signal cointegrator 2 antibody
    • AIB3 antibody
    • Amplified in breast cancer 3 protein antibody
    • Cancer amplified transcriptional coactivator ASC 2 antibody
    • NCOA6 antibody
    • Nuclear receptor coactivator 6 antibody
    • Nuclear receptor coactivator RAP250 antibody
    • PPAR interacting protein antibody
    • Thyroid hormone receptor binding protein antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for ASC-2/NRC using ab238848 at 1/100 dilution in immunohistochemical analysis.

References

ab238848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up