Overview

  • Product name

  • Description

    Rabbit polyclonal to ASC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ASC1 aa 360-535.
    Sequence:

    TLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGF GLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSW YTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLG CVDLIDCLSQKQFKEQFPDISQESDS


    Database link: Q15650

  • Positive control

    • WB: HeLa whole cell lysate (ab150035). IHC-P: Human lung tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 66 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Transcription coactivator of nuclear receptors which functions in conjunction with CBP-p300 and SRC-1 and may play an important role in establishing distinct coactivator complexes under different cellular conditions. Plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. Acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. Plays a role in androgen receptor transactivation and in testicular function.
  • Cellular localization

    Nucleus. Cytoplasm. Cytoplasmic under conditions of serum deprivation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activating signal cointegrator 1 antibody
    • ASC 1 antibody
    • ASC-1 antibody
    • HsT17391 antibody
    • Thyroid hormone receptor interactor 4 antibody
    • Thyroid receptor interacting protein 4 antibody
    • Thyroid receptor-interacting protein 4 antibody
    • TR-interacting protein 4 antibody
    • TRIP 4 antibody
    • TRIP-4 antibody
    • Trip4 antibody
    • TRIP4_HUMAN antibody
    • ZC2HC5 antibody
    • Zinc finger C2HC5 type antibody
    see all

Images

  • Anti-ASC1 antibody (ab236996) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 66 kDa

  • Paraffin-embedded human lung tissue stained for ASC1 using ab236996 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ASC1 (green) using ab236996 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up