Overview

  • Product name

    Anti-ASF1b antibody [6G7G4]
    See all ASF1b primary antibodies
  • Description

    Mouse monoclonal [6G7G4] to ASF1b
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human, African green monkey, Chinese hamster
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human ASF1b aa 1-202. Expressed in E. coli.
    Sequence:

    MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAES EEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCT YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMD CI


    Database link: Q9NVP2

  • Positive control

    • WB: Recombinant human ASF1b protein (amino acids 1-202). ASF1b (amino acids 1-202) - hIgGFc transfected HEK-293 cell lysate. HeLa, COS-7, HCT 116 and CHO3D10 cell lysate. Flow Cytometry: K562 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 22.4 kDa.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA. Required for spermatogenesis.
  • Tissue specificity

    Highly expressed in testis and at lower levels in colon, small intestine and thymus.
  • Sequence similarities

    Belongs to the ASF1 family.
  • Post-translational
    modifications

    Phosphorylated by TLK1 and TLK2.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Anti silencing function 1B antibody
    • Anti silencing function 1B histone chaperone antibody
    • Anti-silencing function protein 1 homolog B antibody
    • ASF1 anti silencing function 1 homolog B (S. cerevisiae) antibody
    • ASF1 anti silencing function 1 homolog B antibody
    • ASF1B antibody
    • ASF1B_HUMAN antibody
    • CCG1 interacting factor A II antibody
    • CCG1-interacting factor A-II antibody
    • CIA-II antibody
    • hAsf1 antibody
    • hAsf1b antibody
    • hCIA-II antibody
    • Histone chaperone ASF1B antibody
    see all

Images

  • Flow Cytometry analysis of K562 (Human chronic myelogenous leukemia cell line from bone marrow) cells, labeling ASF1b with ab233559 at a 1/200 dilution (green) compared to a negative control (red).

  • All lanes : Anti-ASF1b antibody [6G7G4] (ab233559) at 1/500 dilution

    Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : COS-7 (African green monkey kidney fibroblast-like cell line) cell lysate
    Lane 3 : HCT 116 (Human colorectal carcinoma cell line) cell lysate
    Lane 4 : CHO3D10 cell lysate

    Predicted band size: 22.4 kDa

  • All lanes : Anti-ASF1b antibody [6G7G4] (ab233559) at 1/500 dilution

    Lane 1 : HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : ASF1b (amino acids 1-202) - hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 22.4 kDa

  • Anti-ASF1b antibody [6G7G4] (ab233559) at 1/500 dilution + Recombinant human ASF1b protein (amino acids 1-202)

    Predicted band size: 22.4 kDa



    (Expected MW is 48.4 kDa)

     

     

References

ab233559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up