Overview

  • Product name

  • Description

    Rabbit polyclonal to ASGR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ASGR2 aa 106-286.
    Sequence:

    STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV DLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYC QLENAHLVVINSWEEQKFIVQHTNPFNTWIGLTDSGSWKWVDGTDYRHNY KNWAVTQPDNWHGHELGGSEDCVEVQPDGR


    Database link: P07307

  • Positive control

    • IHC-P: Human liver tissue.
  • General notes

    Previously labelled as Asialoglycoprotein Receptor 2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.

Target

  • Function

    Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
  • Tissue specificity

    Expressed exclusively in hepatic parenchymal cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ASGP R antibody
    • ASGP-R 2 antibody
    • ASGPR 2 antibody
    • ASGPR2 antibody
    • Asgr2 antibody
    • ASGR2_HUMAN antibody
    • Asialoglycoprotein receptor 2 antibody
    • C type lectin domain family 4 member H2 antibody
    • C-type lectin domain family 4 member H2 antibody
    • CLEC4H2 antibody
    • HBxAg-binding protein antibody
    • HBXBP antibody
    • Hepatic lectin 2 antibody
    • Hepatic lectin H2 antibody
    • Hepatic lectin R2/3 antibody
    • HL-2 antibody
    • Hs.1259 antibody
    • L H2 antibody
    • LH2 antibody
    • MGC108546 antibody
    • MHL 2 antibody
    • RHL2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for ASGR2 using ab230774 at 1/100 dilution in immunohistochemical analysis.

References

ab230774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up