Anti-Asialoglycoprotein Receptor 1/HL-1 antibody (ab231548)
Key features and details
- Rabbit polyclonal to Asialoglycoprotein Receptor 1/HL-1
- Suitable for: WB, IHC-P
- Reacts with: Human, Pig
- Isotype: IgG
Overview
-
Product name
Anti-Asialoglycoprotein Receptor 1/HL-1 antibody
See all Asialoglycoprotein Receptor 1/HL-1 primary antibodies -
Description
Rabbit polyclonal to Asialoglycoprotein Receptor 1/HL-1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human, Pig
Predicted to work with: Orangutan -
Immunogen
Recombinant fragment (His-tag) corresponding to Human Asialoglycoprotein Receptor 1/HL-1 aa 77-289. N-terminal tag. Expressed in E.coli.
Sequence:FSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLH VKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWA DADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDG TDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWV CETELDKASQEPP
Database link: P07306 -
Positive control
- IHC-P: Human liver tissue. WB: Pig liver lysate; Recombinant human Asialoglycoprotein Receptor 1/HL-1 protein.
-
General notes
Previously labelled as Asialoglycoprotein Receptor 1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231548 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab231548 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 33 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. -
Tissue specificity
Expressed exclusively in hepatic parenchymal cells. -
Sequence similarities
Contains 1 C-type lectin domain. -
Post-translational
modificationsPhosphorylated on a cytoplasmic Ser residue. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 432 Human
- Entrez Gene: 100172364 Orangutan
- Omim: 108360 Human
- SwissProt: P07306 Human
- SwissProt: Q5RBQ8 Orangutan
- Unigene: 12056 Human
-
Alternative names
- ASGP-R 1 antibody
- ASGPR 1 antibody
- ASGPR antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Asialoglycoprotein Receptor 1/HL-1 antibody (ab231548)
Paraffin-embedded human liver tissue stained for Asialoglycoprotein Receptor 1/HL-1 using ab231548 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Asialoglycoprotein Receptor 1/HL-1 antibody (ab231548) at 3 µg/ml + Pig liver lysate
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 33 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Asialoglycoprotein Receptor 1/HL-1 antibody (ab231548)
Paraffin-embedded human liver tissue stained for Asialoglycoprotein Receptor 1/HL-1 using ab231548 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Asialoglycoprotein Receptor 1/HL-1 antibody (ab231548) at 3 µg/ml + Recombinant human Asialoglycoprotein Receptor 1/HL-1 protein
Predicted band size: 33 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231548 has not yet been referenced specifically in any publications.