Overview

  • Product name

    Anti-Asialoglycoprotein Receptor 1/HL-1 antibody
    See all Asialoglycoprotein Receptor 1/HL-1 primary antibodies
  • Description

    Rabbit polyclonal to Asialoglycoprotein Receptor 1/HL-1
  • Host species

    Rabbit
  • Specificity

    This antibody recognizes Asialoglycoprotein Receptor 1/HL-1

  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human Asialoglycoprotein Receptor 1/HL-1 aa 100-149 (internal sequence). The exact sequence is proprietary.
    Sequence:

    RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS


    Database link: P07306

  • Positive control

    • Fetal liver lysate
  • General notes

    Previously labelled as Asialoglycoprotein Receptor 1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab49355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.6 µg/ml. Detects a band of approximately 46 kDa (predicted molecular weight: 33 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
  • Tissue specificity

    Expressed exclusively in hepatic parenchymal cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    Phosphorylated on a cytoplasmic Ser residue.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ASGP-R 1 antibody
    • ASGPR 1 antibody
    • ASGPR antibody
    • ASGPR1 antibody
    • Asgr1 antibody
    • ASGR1_HUMAN antibody
    • Asialoglycoprotein receptor 1 antibody
    • C type lectin domain family 4 member H1 antibody
    • C-type lectin domain family 4 member H1 antibody
    • CLEC4H1 antibody
    • Hepatic lectin H1 antibody
    • HL-1 antibody
    see all

Images

  • Western Blot using ab49355 at 1.0ug/ml. Sample type: Human 293T cell Lysate
  • Western Blot using ab49355 at 1.0ug/ml. Sample type: Human Hela Lysate
  • Western Blot using ab49355 at 1.0ug/ml. Sample type: Hum. Adult Placenta Lysate
  • Western Blot using ab49355 at 1.0ug/ml. Sample type: Hum. Fetal Heart Lysate
  • Western Blot using ab49355 at 1.0ug/ml. Sample type: Hum. Fetal Kidney Lysate
  • Western Blot using ab49355 at 1.0ug/ml. Sample type: Hum. Fetal Lung Lysate
  • Western Blot using ab49355 at 1.0ug/ml. Sample type: Human Jurkat Lysate
  • Western Blot using ab49355 at 1.0ug/ml. Sample type: Human MCF7 Cell Lysate
  • Anti-Asialoglycoprotein Receptor 1/HL-1 antibody (ab49355) at 0.6 µg/ml + Fetal liver lysate at 10 µg with 5% skim milk in PBS.

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 33 kDa
    Observed band size: 46 kDa
    why is the actual band size different from the predicted?

  • IHC image of ab49355 staining in human normal liver formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab49355, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

References

This product has been referenced in:

  • Willoughby JLS  et al. Evaluation of GalNAc-siRNA Conjugate Activity in Pre-clinical Animal Models with Reduced Asialoglycoprotein Receptor Expression. Mol Ther 26:105-114 (2018). WB . Read more (PubMed: 28988716) »
See 1 Publication for this product

Customer reviews and Q&As

Answer

Thank you for contacting us.

Immunohistochemistry on frozen sections is the best technique for snap frozen sections. Please click the link below to know about IHC-FR

https://www.abcam.com/index.html?pageconfig=resource&rid=11383

https://www.abcam.com/index.html?pageconfig=resource&rid=11462

https://www.abcam.com/index.html?pageconfig=popular_protocols

There are many proteins that can be used as Marker for Endoplasmic reticulum, Phagosomes, Mitochondria, vacoules, peroxisomes etc. Please click the below link to find the target proteins

https://www.abcam.com/index.html?pageconfig=productmap&cl=251

Mitochondrial marker prtoeins; http://www.antibodybeyond.com/reviews/organelle-markers/mitochondria-marker.htm
ab64885, ab14744 etc

ab54789, ab102806 and ab104339 are few of anti vacoule antibodies.

ab49355 and ab72208 are anti vesicle antibodies.

ab89116, ab102545 and ab52759 are the anti peroxisome antibodies.

Please check the information provided on the datasheet of these products you will be able to select the right one for you.

PS: http://www.antibodybeyond.com/reviews/organelle-markers/mitochondria-marker.htm; this website is also very good to know about the markers expressed by organelles, cells or tissues.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up