Anti-Asialoglycoprotein Receptor 1/HL-1 antibody - N-terminal (ab223769)

Overview

  • Product name

    Anti-Asialoglycoprotein Receptor 1/HL-1 antibody - N-terminal
    See all Asialoglycoprotein Receptor 1/HL-1 primary antibodies
  • Description

    Rabbit polyclonal to Asialoglycoprotein Receptor 1/HL-1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Asialoglycoprotein Receptor 1/HL-1 aa 1-41 (N terminal).
    Sequence:

    MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRL


    Database link: P07306

  • Positive control

    • IHC-P: Human liver tissue. WB: HepG2 cell lysate. ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as Asialoglycoprotein Receptor 1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 33 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
  • Tissue specificity

    Expressed exclusively in hepatic parenchymal cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    Phosphorylated on a cytoplasmic Ser residue.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ASGP-R 1 antibody
    • ASGPR 1 antibody
    • ASGPR antibody
    • ASGPR1 antibody
    • Asgr1 antibody
    • ASGR1_HUMAN antibody
    • Asialoglycoprotein receptor 1 antibody
    • C type lectin domain family 4 member H1 antibody
    • C-type lectin domain family 4 member H1 antibody
    • CLEC4H1 antibody
    • Hepatic lectin H1 antibody
    • HL-1 antibody
    see all

Images

  • Paraffin-embedded human liver tissue staining Asialoglycoprotein Receptor 1 with ab223769 at 1/500 dilution in immunohistochemical analysis. High expression shown.

  • Anti-Asialoglycoprotein Receptor 1/HL-1 antibody - N-terminal (ab223769) at 1/100 dilution + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 33 kDa

  • PFA-fixed, Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Asialoglycoprotein Receptor 1/HL-1 (green) using ab223769 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human colon tissue staining Asialoglycoprotein Receptor 1 with ab223769 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for Asialoglycoprotein Receptor 1/HL-1 using ab223769 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue staining Asialoglycoprotein Receptor 1 with ab223769 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lymph node tissue staining Asialoglycoprotein Receptor 1 with ab223769 at 1/500 dilution in immunohistochemical analysis.

References

ab223769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Liver)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: ab64236 100x Citrate Buffer pH 6.0
Specification
Liver
Blocking step
sea block as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 22°C
Fixative
Formaldehyde

Mr. David Ivancic

Verified customer

Submitted Jul 02 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up