Overview

  • Product name

    Anti-ASIC1 antibody - N-terminal
    See all ASIC1 primary antibodies
  • Description

    Rabbit polyclonal to ASIC1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human ASIC1 aa 38-87 (N terminal). The exact sequence is proprietary.
    Sequence:

    RLSLKRALWALCFLGSLAVLLCVCTERVQYYFHYHHVTKLDEVAASQLTF


    Database link: F8VSK4

  • Positive control

    • WB: 721_B cell lysate.
  • General notes

    Protein previously known as ACCN2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa.

Target

  • Function

    Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Ca(2+), Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Mediates glutamate-independent Ca(2+) entry into neurons upon acidosis. This Ca(2+) overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Functions as a postsynaptic proton receptor that influences intracellular Ca(2+) concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. Modulates activity in the circuits underlying innate fear.
  • Tissue specificity

    Expressed in most or all neurons.
  • Sequence similarities

    Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ACCN2 subfamily.
  • Post-translational
    modifications

    Phosphorylation by PKA regulates interaction with PRKCABP and subcellular location. Phosphorylation by PKC may regulate the channel.
  • Cellular localization

    Cell membrane. Localizes in synaptosomes at dendritic synapses of neurons. Colocalizes with DLG4.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACCN2 antibody
    • ACCN2_HUMAN antibody
    • Acid sensing ion channel 1 antibody
    • Acid sensing ion channel 1a protein antibody
    • Acid sensing ion channel antibody
    • Acid-sensing ion channel 1 antibody
    • AI843610 antibody
    • Amiloride sensitive cation channel 2 neuronal antibody
    • Amiloride-sensitive cation channel 2 antibody
    • ASIC antibody
    • ASIC1 antibody
    • ASIC1A antibody
    • B530003N02Rik antibody
    • BNaC2 antibody
    • Brain sodium channel 2 antibody
    • Cation channel amiloride sensitive neuronal 2 antibody
    • hBNaC2 antibody
    • neuronal antibody
    see all

Images

  • Anti-ASIC1 antibody - N-terminal (ab186884) at 1 µg/ml + 721_B whole cell lysate at 10 µg

    Predicted band size: 60 kDa

References

ab186884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up