Anti-ASIC1 antibody - N-terminal (ab186884)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ASIC1 antibody - N-terminal
See all ASIC1 primary antibodies -
Description
Rabbit polyclonal to ASIC1 - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Pig, Zebrafish
-
Immunogen
Synthetic peptide within Human ASIC1 aa 38-87 (N terminal). The exact sequence is proprietary.
Sequence:RLSLKRALWALCFLGSLAVLLCVCTERVQYYFHYHHVTKLDEVAASQLTF
Database link: F8VSK4 -
Positive control
- WB: 721_B cell lysate.
-
General notes
Protein previously known as ACCN2.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab186884 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. |
Target
-
Function
Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Ca(2+), Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Mediates glutamate-independent Ca(2+) entry into neurons upon acidosis. This Ca(2+) overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Functions as a postsynaptic proton receptor that influences intracellular Ca(2+) concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. Modulates activity in the circuits underlying innate fear. -
Tissue specificity
Expressed in most or all neurons. -
Sequence similarities
Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ACCN2 subfamily. -
Post-translational
modificationsPhosphorylation by PKA regulates interaction with PRKCABP and subcellular location. Phosphorylation by PKC may regulate the channel. -
Cellular localization
Cell membrane. Localizes in synaptosomes at dendritic synapses of neurons. Colocalizes with DLG4. - Information by UniProt
-
Database links
- Entrez Gene: 100059851 Horse
- Entrez Gene: 41 Human
- Entrez Gene: 11419 Mouse
- Entrez Gene: 79123 Rat
- Omim: 602866 Human
- SwissProt: P78348 Human
- SwissProt: Q6NXK8 Mouse
- SwissProt: P55926 Rat
see all -
Alternative names
- ACCN2 antibody
- ACCN2_HUMAN antibody
- Acid sensing ion channel 1 antibody
see all
Images
-
Western blot - Anti-ASIC1 antibody - N-terminal (ab186884)Anti-ASIC1 antibody - N-terminal (ab186884) at 1 µg/ml + 721_B whole cell lysate at 10 µg
Predicted band size: 60 kDa
Protocols
Datasheets and documents
References
ab186884 has not yet been referenced specifically in any publications.
