Overview

  • Product name

    Anti-Aspartate Aminotransferase antibody
    See all Aspartate Aminotransferase primary antibodies
  • Description

    Rabbit polyclonal to Aspartate Aminotransferase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Pig, Chimpanzee, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Aspartate Aminotransferase aa 358-413.
    Sequence:

    IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHE AVTKIQ


    Database link: P17174

  • Positive control

    • ICC/IF: U-2 OS cells. IHC-P: Human liver tissue. WB: Human liver and tonsil lysates; RT4 and U-251 MG cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab221939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 46 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-Aspartate Aminotransferase antibody (ab221939) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 46 kDa

  • Paraffin-embedded human liver tissue stained for Aspartate Aminotransferase using ab221939 at 1/1000 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Aspartate Aminotransferase (green) using ab221939 at 4 µg/ml in ICC/IF.

References

ab221939 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up