Overview

  • Product name

    Anti-Aspartate Aminotransferase antibody
    See all Aspartate Aminotransferase primary antibodies
  • Description

    Rabbit polyclonal to Aspartate Aminotransferase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
    Predicted to work with: Mouse, Rat, Human, Pig, Chimpanzee, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Cow Aspartate Aminotransferase aa 2-413. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    APPSIFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDSQPWVL PVVRKVEQRIANDSSINHEYLPILGLAEFRTCASRLALGDDSPALQEKRV GGVQCLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFIAA GFKDIRSYHYWDAAKRGLDLQGFLNDLEKAPEFSIFVLHACAHNPTGTDP TPEQWKQIASVMKRRFLFPFFDSAYQGFASGSLEKDAWAIRYFVSEGFEL FCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMEKIVRITWSNPPA QGARIVARTLSDPELFNEWTGNVKTMADRILTMRSELRARLEALKTPGTW NHITEQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINMCGLTTKNLEYV ATSIHEAVTKIQ


    Database link: P33097

  • Positive control

    • WB: Cow liver, cerebrum and heart lysates; Recombinant cow Aspartate Aminotransferase protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 46 kDa.

Target

Images

  • All lanes : Anti-Aspartate Aminotransferase antibody (ab232750) at 2 µg/ml

    Lane 1 : Cow brain lysate
    Lane 2 : Cow heart lysate
    Lane 3 : Cow liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 46 kDa

  • Anti-Aspartate Aminotransferase antibody (ab232750) at 2 µg/ml + Recombinant cow Aspartate Aminotransferase protein.

    Predicted band size: 46 kDa

References

ab232750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up