Overview

  • Product name

    Anti-Aspartate Aminotransferase antibody [C1]
    See all Aspartate Aminotransferase primary antibodies
  • Description

    Mouse monoclonal [C1] to Aspartate Aminotransferase
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Pig
    Predicted to work with: Horse, Cow, Chimpanzee, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Aspartate Aminotransferase aa 1-413. N-terminal His Tag. Expressed in E.coli.
    Sequence:

    MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV LPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKR VGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSA AGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGID PTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFE FFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPP AQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGT WNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDY VATSIHEAVTKIQ


    Database link: P17174

  • Positive control

    • WB: Recombinant Aspartate Aminotransferase protein; Human and mouse liver lysates; Rat liver, brain and heart lysate; Pig brain and heart lysate. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239487 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml.

Target

Images

  • All lanes : Anti-Aspartate Aminotransferase antibody [C1] (ab239487) at 2 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Pig heart lysate

    Secondary
    All lanes : HRP-linked Rabbit anti-Mouse IgG at 1/5000 dilution
  • Paraffin-embedded human kidney tissue stained for Aspartate Aminotransferase using ab239487 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Aspartate Aminotransferase antibody [C1] (ab239487) at 3 µg/ml + Rat heart lysate

    Secondary
    HRP-linked caprine anti-mouse polyclonal IgG at 0.2 µg/ml
  • Anti-Aspartate Aminotransferase antibody [C1] (ab239487) at 3 µg/ml + Rat brain lysate

    Secondary
    HRP-linked caprine anti-mouse polyclonal IgG at 0.2 µg/ml
  • Anti-Aspartate Aminotransferase antibody [C1] (ab239487) at 3 µg/ml + Rat liver lysate

    Secondary
    HRP-linked caprine anti-mouse polyclonal IgG at 0.2 µg/ml
  • Anti-Aspartate Aminotransferase antibody [C1] (ab239487) at 3 µg/ml + Mouse liver lysate

    Secondary
    HRP-linked caprine anti-mouse polyclonal IgG at 0.2 µg/ml
  • Anti-Aspartate Aminotransferase antibody [C1] (ab239487) at 3 µg/ml + Human liver lysate

    Secondary
    HRP-linked caprine anti-mouse polyclonal IgG at 0.2 µg/ml
  • Anti-Aspartate Aminotransferase antibody [C1] (ab239487) at 5 µg/ml + Recombinant human aspartate aminotransferase protein

References

ab239487 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239487.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up