Overview

  • Product name

    Anti-Aspartyl Aminopeptidase antibody
    See all Aspartyl Aminopeptidase primary antibodies
  • Description

    Rabbit polyclonal to Aspartyl Aminopeptidase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Aspartyl Aminopeptidase aa 279-396.
    Sequence:

    SCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRISASCQ HPTAFEEAIPKSFMISADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSK QRYASNAVSEALIREVAN


    Database link: Q9ULA0

  • Positive control

    • IHC-P: Human small intestine tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab239031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.
ICC/IF 1/200 - 1/500.

Target

  • Function

    Aminopeptidase with specificity towards an acidic amino acid at the N-terminus. Likely to play an important role in intracellular protein and peptide metabolism.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the peptidase M18 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aspartyl aminopeptidase antibody
    • ASPEP antibody
    • DAP antibody
    • DNPEP antibody
    • DNPEP_HUMAN antibody
    see all

Images

  • MCF7 (Human breast adenocarcinoma cell line) cells stained for Aspartyl Aminopeptidase (Green) using ab239031 at 1/200 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C. The nuclear counterstain was DAPI (Blue).

  • Paraffin-embedded human small intestine tissue stained for Aspartyl Aminopeptidase, using ab239031 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab239031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up