Overview

  • Product name

  • Description

    Rabbit polyclonal to ASPDH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ASPDH aa 10-114.
    Sequence:

    GVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQN LAALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQ


    Database link: A6ND91

  • Positive control

    • IHC-P: Human prostate tissue. WB: Human liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab243515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 30 kDa.

Target

Images

  • All lanes : Anti-ASPDH antibody (ab243515) at 0.4 µg/ml

    Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 30 kDa

  • Paraffin-embedded human prostate tissue stained for ASPDH using ab243515 at 1/200 dilution in immunohistochemical analysis.

References

ab243515 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up