Overview

  • Product name

  • Description

    Rabbit polyclonal to ASPRV1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ASPRV1 aa 180-263.
    Sequence:

    SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPNLWEEVT DGDLDTLQPFENVVKVANGAEMKILGVWDTAVSL


    Database link: Q53RT3

  • Positive control

    • IHC-P: Human skin, colon, cerebral cortex and liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Expressed primarily in the granular layer of the epidermis and inner root sheath of hair follicles. In psoriatic skin, expressed throughout the stratum corneum. In ulcerated skin, expressed in the stratum granulosum of intact epidermis but almost absent from ulcerated regions. Expressed in differentiated areas of squamous cell carcinomas but not in undifferentiated tumors. The specific function of ASPRV1 is not yet known.
  • Cellular localization

    Membrane; Single-pass type I membrane protein
  • Database links

  • Alternative names

    • Aspartic peptidase, retroviral like 1 antibody
    • MUNO antibody
    • SASP antibody
    • SASPase antibody
    • Skin aspartic protease antibody
    • Taps antibody
    • TPA inducible aspartic proteinase like protein antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for ASPRV1 using ab244449 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for ASPRV1 using ab244449 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for ASPRV1 using ab244449 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for ASPRV1 using ab244449 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for ASPRV1 using ab244449 at 1/200 dilution in immunohistochemical analysis. Low expression, as expected.

References

ab244449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up