Overview

  • Product name

  • Description

    Rabbit polyclonal to Ataxin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Ataxin 1 aa 586-815.
    Sequence:

    ELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGE HRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISL TLKNLKNGSVKKGQPVDPASVLLKHSKADGLAGSRHRYAEQENGINQGSA QMLSENGELKFPEKMGLPAAPFLTKIEPSKPAATRKRRWSAPESRKLEKS EDEPPLTLPKPSLIPQEVKICIEGRSNVGK


    Database link: P54253

  • Positive control

    • IHC-P: Human gallbladder tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Binds RNA in vitro. May be involved in RNA metabolism. The expansion of the polyglutamine tract may alter this function.
  • Tissue specificity

    Widely expressed throughout the body.
  • Involvement in disease

    Defects in ATXN1 are the cause of spinocerebellar ataxia type 1 (SCA1) [MIM:164400]; also known as olivopontocerebellar atrophy I (OPCA I or OPCA1). Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to cerebellum degeneration with variable involvement of the brainstem and spinal cord. SCA1 belongs to the autosomal dominant cerebellar ataxias type I (ADCA I) which are characterized by cerebellar ataxia in combination with additional clinical features like optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy and dementia. SCA1 is caused by expansion of a CAG repeat in the coding region of ATXN1. Longer expansions result in earlier onset and more severe clinical manifestations of the disease.
  • Sequence similarities

    Belongs to the ATXN1 family.
    Contains 1 AXH domain.
  • Domain

    The AXH domain is required for interaction with CIC.
  • Post-translational
    modifications

    Phosphorylation at Ser-775 increases the pathogenicity of proteins with an expanded polyglutamine tract.
    Sumoylation is dependent on nuclear localization and phosphorylation at Ser-775. It is reduced in the presence of an expanded polyglutamine tract.
  • Cellular localization

    Cytoplasm. Nucleus. Colocalizes with USP7 in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • alternative ataxin1 antibody
    • Ataxin-1 antibody
    • ATX1 antibody
    • ATX1_HUMAN antibody
    • Atxn1 antibody
    • D6S504E antibody
    • OTTHUMP00000016065 antibody
    • SCA1 antibody
    • Spinocerebellar ataxia type 1 protein antibody
    see all

Images

  • Paraffin-embedded human gallbladder tissue stained for Ataxin 1 using ab238105 at 1/100 dilution in immunohistochemical analysis.

References

ab238105 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238105.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up