Anti-Ataxin 3 antibody (ab175265)
Key features and details
- Rabbit polyclonal to Ataxin 3
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Ataxin 3 antibody
See all Ataxin 3 primary antibodies -
Description
Rabbit polyclonal to Ataxin 3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant full length protein corresponding to Human Ataxin 3 aa 1-364.
Sequence:MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAE GGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQ RLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLAL FLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLK EQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLR RAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQ QQQQQGDLSGQSSHPCERPATSSGALGSDLGKACSPFIMFATFTLYLTYE LHVIFALHYSSFPL
Database link: P54252 -
Positive control
- MCF7 whole cell lysate (ab29537) can be used as a positive control in WB. MCF7 cell lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175265 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use at an assay dependent concentration.
|
|
IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
WB |
1/500 - 1/2000. Predicted molecular weight: 42 kDa.
|
Notes |
---|
ICC/IF
Use at an assay dependent concentration. |
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
WB
1/500 - 1/2000. Predicted molecular weight: 42 kDa. |
Target
-
Function
Interacts with key regulators (CBP, p300 and PCAF) of transcription and represses transcription. Acts as a histone-binding protein that regulates transcription. Acts as a deubiquitinating enzyme. -
Tissue specificity
Ubiquitous. -
Involvement in disease
Defects in ATXN3 are the cause of spinocerebellar ataxia type 3 (SCA3) [MIM:109150]; also known as Machado-Joseph disease (MJD). Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA3 belongs to the autosomal dominant cerebellar ataxias type I (ADCA I) which are characterized by cerebellar ataxia in combination with additional clinical features like optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy and dementia. The molecular defect in SCA3 is the a CAG repeat expansion in ATXN3 coding region. Longer expansions result in earlier onset and more severe clinical manifestations of the disease. -
Sequence similarities
Contains 1 Josephin domain.
Contains 3 UIM (ubiquitin-interacting motif) repeats. -
Cellular localization
Nucleus matrix. Predominantly nuclear, but not exclusively, inner nuclear matrix. - Information by UniProt
-
Database links
- Entrez Gene: 4287 Human
- Entrez Gene: 60331 Rat
- Omim: 607047 Human
- SwissProt: P54252 Human
- SwissProt: O35815 Rat
- Unigene: 532632 Human
- Unigene: 42932 Rat
-
Alternative names
- AT3 antibody
- Ataxin 3 antibody
- ataxin 3 variant h antibody
see all
Images
-
Anti-Ataxin 3 antibody (ab175265) at 1/500 dilution + MCF7 cell lysate
Predicted band size: 42 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung cancer tissue labelling Ataxin 3 with ab175265 at 1/200. Magnification: 400x.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat kidney tissue labelling Ataxin 3 with ab175265 at 1/200. Magnification: 400x.
-
Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175265. Blue DAPI for nuclear staining.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab175265 has been referenced in 3 publications.
- Lin YS et al. IGF-1 as a Potential Therapy for Spinocerebellar Ataxia Type 3. Biomedicines 10:N/A (2022). PubMed: 35203722
- Ouyang S et al. CRISPR/Cas9-Targeted Deletion of Polyglutamine in Spinocerebellar Ataxia Type 3-Derived Induced Pluripotent Stem Cells. Stem Cells Dev 27:756-770 (2018). PubMed: 29661116
- Datson NA et al. The expanded CAG repeat in the huntingtin gene as target for therapeutic RNA modulation throughout the HD mouse brain. PLoS One 12:e0171127 (2017). PubMed: 28182673