Overview

  • Product name

    Anti-ATF-4 antibody [N360A/24]
    See all ATF-4 primary antibodies
  • Description

    Mouse monoclonal [N360A/24] to ATF-4
  • Host species

    Mouse
  • Specificity

    ab186284 has <50% identity with ATF5, it does not cross-react with this protein.
  • Tested applications

    Suitable for: IHC-Fr, WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ATF-4 aa 25-327.
    Sequence:

    LGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNS KEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFA PLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTP DHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMS PESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVK GEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERA DSL


    Database link: P18848

  • Positive control

    • WB: Rat brain lysate. ICC/IF: SK-N-BE cells.
  • General notes

    The clone number has been updated from S360A-24 to N360A/24, both clone numbers name the same antibody clone.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.09% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    N360A/24
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration.
WB 1/1000. Detects a band of approximately 60 kDa (predicted molecular weight: 39 kDa).
IHC-P Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. It binds to a Tax-responsive enhancer element in the long terminal repeat of HTLV-I.
  • Sequence similarities

    Belongs to the bZIP family.
    Contains 1 bZIP domain.
  • Cellular localization

    Cytoplasm. Cell membrane. Nucleus. Colocalizes with GABBR1 in hippocampal neuron dendritic membranes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activating transcription factor 4 antibody
    • ATF 4 antibody
    • ATF4 antibody
    • ATF4 protein antibody
    • ATF4_HUMAN antibody
    • cAMP-dependent transcription factor ATF-4 antibody
    • cAMP-responsive element-binding protein 2 antibody
    • CREB 2 antibody
    • CREB-2 antibody
    • CREB2 antibody
    • Cyclic AMP dependent transcription factor ATF 4 antibody
    • Cyclic AMP response element binding protein 2 antibody
    • Cyclic AMP-dependent transcription factor ATF-4 antibody
    • Cyclic AMP-responsive element-binding protein 2 antibody
    • DNA binding protein TAXREB67 antibody
    • DNA-binding protein TAXREB67 antibody
    • Tax Responsive Enhancer Element B67 antibody
    • Tax-responsive enhancer element-binding protein 67 antibody
    • TaxREB67 antibody
    • TXREB antibody
    see all

Images

  • SK-N-BE (Human neuroblastoma cell line) cells stained for ATF-4 (Green) using ab186284 at a 1/100 dilution (1 hour at RT) in ICC/IF.

    Cells were fixed in 4% formaldehyde for 15 minutes at RT.

    Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 1 hour at RT.

  • Anti-ATF-4 antibody [N360A/24] (ab186284) at 1/2000 dilution + Rat brain lysate at 15 µg

    Secondary
    Goat Anti-Mouse IgG: HRP at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 39 kDa


    Exposure time: 5 minutes


    Block: 5% Skimmed milk in 1X TBST.

    Primary antibody incubated for 2 hours at RT.

    Secondary antibody incubated for 1 hour at RT.

References

ab186284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up