Overview

  • Product name

    Anti-ATF3 antibody [5A9B9]
    See all ATF3 primary antibodies
  • Description

    Mouse monoclonal [5A9B9] to ATF3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human ATF3 aa 1-181. (Expressed in E.coli).
    Sequence:

    MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQ NKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAA AKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHR PTCIVRAQNGRTPEDERNLFIQQIKEGTLQS


    Database link: P18847

  • Positive control

    • WB: Recombinant human ATF3 protein; ATF3 (aa: 1-181)-hIgGFc transfected HEK-293 cell lysate. Flow: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    5A9B9
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.
  • Sequence similarities

    Belongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activating transcription factor 3 antibody
    • ATF3 antibody
    • ATF3_HUMAN antibody
    • ATF3deltaZip2 antibody
    • ATF3deltaZip2c antibody
    • ATF3deltaZip3 antibody
    • cAMP dependent transcription factor ATF3 antibody
    • cAMP-dependent transcription factor ATF-3 antibody
    • Cyclic AMP dependent transcription factor ATF3 antibody
    • Cyclic AMP-dependent transcription factor ATF-3 antibody
    see all

Images

  • All lanes : Anti-ATF3 antibody [5A9B9] (ab233797) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : ATF3 (AA: 1-181)-hIgGFc transfected HEK-293 cell lysate
  • Anti-ATF3 antibody [5A9B9] (ab233797) at 1/500 dilution + Recombinant human ATF3 protein


    Expected MW is 46.5 kDa

  • Flow cytometric analysis of A549 (human lung carcinoma cell line) cells labeling ATF3 using ab233797 at 1/200 dilution (green) compared with a negative control (red).

References

ab233797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up