Overview

  • Product name

  • Description

    Rabbit polyclonal to ATF3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human ATF3 aa 1-181. (BC006322).
    Sequence:

    MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQ NKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAA AKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHR PTCIVRAQNGRTPEDERNLFIQQIKEGTLQS


    Database link: P18847

  • Positive control

    • Human placenta tissue.

Properties

  • Form

    Lyophilised:Reconstitute in 200 µl of steriled distilled water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.
  • Sequence similarities

    Belongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activating transcription factor 3 antibody
    • ATF3 antibody
    • ATF3_HUMAN antibody
    • ATF3deltaZip2 antibody
    • ATF3deltaZip2c antibody
    • ATF3deltaZip3 antibody
    • cAMP dependent transcription factor ATF3 antibody
    • cAMP-dependent transcription factor ATF-3 antibody
    • Cyclic AMP dependent transcription factor ATF3 antibody
    • Cyclic AMP-dependent transcription factor ATF-3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue labeling ATF3 with ab176872 at 1/100 dilution.

References

ab176872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up