Overview

  • Product name

  • Description

    Rabbit polyclonal to ATF3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Cow, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ATF3 aa 1-181.
    Sequence:

    MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQ NKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAA AKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHR PTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

  • Positive control

    • Skeletal Muscle (Mouse) Whole Cell Lysate (ab3869) can be used as a positive control in WB. Mouse heart cell lysate; Mouse skeletal muscle cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 21 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

ICC/IF 1/50 - 1/200.

Target

  • Function

    This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.
  • Sequence similarities

    Belongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activating transcription factor 3 antibody
    • ATF3 antibody
    • ATF3_HUMAN antibody
    • ATF3deltaZip2 antibody
    • ATF3deltaZip2c antibody
    • ATF3deltaZip3 antibody
    • cAMP dependent transcription factor ATF3 antibody
    • cAMP-dependent transcription factor ATF-3 antibody
    • Cyclic AMP dependent transcription factor ATF3 antibody
    • Cyclic AMP-dependent transcription factor ATF-3 antibody
    see all

Images

  • All lanes : Anti-ATF3 antibody (ab180842) at 1/1000 dilution

    Lane 1 : mouse heart tissue lysate
    Lane 2 : mouse skeletal muscle tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L) HRP conjugate

    Predicted band size: 21 kDa

  • Immunocytochemistry/ Immunofluorescence analysis of A549 cells labeling ATF3 with ab180842 at 1/100 dilution. A Goat Anti-Rabbit IgG (H+L) FITC conjugate secondary antibody has been used. DAPI has been used for nuclear staining.

References

This product has been referenced in:

  • Lee S  et al. ATF3 Stimulates IL-17A by Regulating Intracellular Ca2+/ROS-Dependent IL-1ß Activation During Streptococcus pneumoniae Infection. Front Immunol 9:1954 (2018). Read more (PubMed: 30214444) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up