Overview

  • Product name

  • Description

    Rabbit polyclonal to ATF7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse ATF7 aa 50-270. N-terminal tags. Expressed in E. coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-QTPTPTRFLKNCE EVGLFNELASSFEHEFKKASDDDEKKGAAGPLDMSLPSTPDIKIKEEEPV EVDSSPPDSPASSPCSPPLKEKEVTTKPVVISTPTPTIVRPGSLPLHLGY DPLHPTLPSPTSVITQAPPSNRQIGSPTGSLPLVMHLANGQTMPMLPGPP VQMPSVISLARPVSMVPNIPGIPGPPVNNSGSISPSGHPMPSEAKMRLKA TLTHQVSS


    Database link: Q8R0S1

  • Positive control

    • IHC-P: Mouse spleen, liver, pancreas, intestine, ovary and kidney tissue. WB: Recombinant mouse ATF7 protein. Rat stomach tissue lysate. SGC7901 and HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. Activator of the NF-ELAM1/delta-A site of the E-selectin promoter. Has no intrinsic transcriptional activity, but activates transcription on formation of JUN or FOS heterodimers. Also can bind TRE promoter sequences when heterodimerized with members of the JUN family.
    Isoform 4/ATF-A0 acts as a dominant repressor of the E-selectin/NF-ELAM1/delta-A promoter.
  • Tissue specificity

    Expressed in heart, lung and skeletal muscle. Isoform 4 is expressed in various tissues including heart, brain, placenta, lung and skeletal muscle. Highest levels in skeletal muscle. Lowest in lung and placenta.
  • Sequence similarities

    Belongs to the bZIP family.
    Contains 1 bZIP domain.
    Contains 1 C2H2-type zinc finger.
  • Post-translational
    modifications

    On EGF stimulation, phosphorylated first on Thr-53 allowing subsequent phosphorylation on Thr-51. This latter phosphorylation prevents sumoylation, increases binding to TAF12 and enhances transcriptional activity.
    Sumoylation delays nuclear localization and inhibits transactivation activity through preventing binding to TAF12. RANBP2 appears to be the specific E3 ligase.
  • Cellular localization

    Nucleus. Nucleus > nucleoplasm. Mainly nucleoplasmic. Restricted distribution to the perinuculear region. The sumoylated form locates to the nuclear periphery.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110012F10Rik antibody
    • 9430065F09Rik antibody
    • Activating transcription factor 7 antibody
    • AI549878 antibody
    • ATF7 antibody
    • Atf7 protein antibody
    • ATF7_HUMAN antibody
    • ATFA antibody
    • C130020M04Rik antibody
    • cAMP-dependent transcription factor ATF-7 antibody
    • Cyclic AMP-dependent transcription factor ATF 7 antibody
    • Cyclic AMP-dependent transcription factor ATF-7 antibody
    • MGC31554 antibody
    • MGC57182 antibody
    • Transcription factor ATF A antibody
    • Transcription factor ATF-A antibody
    see all

Images

  • All lanes : Anti-ATF7 antibody (ab231786) at 2 µg/ml

    Lane 1 : SGC7901 cell lysate
    Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : Rat stomach tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded mouse intestine tissue stained for ATF7 with ab231786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse ovary tissue stained for ATF7 with ab231786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for ATF7 with ab231786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse spleen tissue stained for ATF7 with ab231786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for ATF7 with ab231786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse pancreas tissue stained for ATF7 with ab231786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ATF7 antibody (ab231786) at 2 µg/ml + Recombinant mouse ATF7 protein

References

ab231786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up