Overview

  • Product name

    Anti-ATG3 antibody [7A1D1]
    See all ATG3 primary antibodies
  • Description

    Mouse monoclonal [7A1D1] to ATG3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, African green monkey
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ATG3 aa 1-100. Expressed in E. coli.
    Sequence:

    MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHC PTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE


    Database link: Q9NT62

  • Positive control

    • WB: Recombinant human ATG3 protein (amino acids 1-100). ATG3 (AA: 1-100) - hIgGFc transfected HEK-293 cell lysate. HeLa, COS-7, Jurkat, THP-1 and K562 cell lysate. ICC/IF: HeLa and SMMC-7721 cells. IHC-P: Human breast cancer and esophageal cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 36 kDa.
IHC-P 1/200 - 1/1000.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    E2-like enzyme involved in autophagy and mitochondrial homeostasis. Catalyzes the conjugation of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A) to phosphatidylethanolamine (PE). PE-conjugation to ATG8-like proteins is essential for autophagy. Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3.
  • Tissue specificity

    Widely expressed, with a highest expression in heart, skeletal muscle, kidney, liver and placenta.
  • Sequence similarities

    Belongs to the ATG3 family.
  • Post-translational
    modifications

    Conjugated to ATG12 at Lys-243. ATG12-conjugation plays a role in regulation of mitochondrial homeostasis and cell death, while it is not involved in PE-conjugation to ATG8-like proteins and autophagy.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2610016C12Rik antibody
    • Apg 3 antibody
    • APG3 antibody
    • APG3 autophagy 3 like antibody
    • APG3 like antibody
    • APG3, S. cerevisiae, homolog of antibody
    • APG3-like antibody
    • APG3L antibody
    • Apg3p antibody
    • ATG 3 antibody
    • ATG3 antibody
    • ATG3 autophagy related 3 homolog antibody
    • ATG3 autophagy related 3 homolog (S. cerevisiae) antibody
    • ATG3_HUMAN antibody
    • Autophagy 3, S. cerevisiae, homolog of antibody
    • Autophagy Apg3p/Aut1p like antibody
    • autophagy related 3 antibody
    • Autophagy related protein 3 antibody
    • Autophagy-related protein 3 antibody
    • DKFZp564M1178 antibody
    • FLJ22125 antibody
    • hApg3 antibody
    • MGC15201 antibody
    • OTTHUMP00000214547 antibody
    • OTTHUMP00000214548 antibody
    • PC3 96 antibody
    • Protein PC3-96 antibody
    • Ubiquitin-like-conjugating enzyme ATG3 antibody
    see all

Images

  • All lanes : Anti-ATG3 antibody [7A1D1] (ab233560) at 1/500 dilution

    Lane 1 : Jurkat (Human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 2 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 3 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 4 : THP-1 (Human monocytic leukemia cell line) cell lysate
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell lysate

    Predicted band size: 36 kDa

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for ATG3 (green) using ab233560 (1/200 dilution) in ICC/IF.

    Blue: DRAQ5 fluorescent DNA dye.

    Red: Actin filaments have been labeled with Alexa Fluor®555 phalloidin.

    Secondary antibody: Goat anti-Mouse IgG (H+L) DyLight 488.

  • Paraffin-embedded human esophageal cancer tissue stained for ATG3 with ab233560 at a 1/200 dilution in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for ATG3 with ab233560 at a 1/200 dilution in immunohistochemical analysis. DAB staining.

  • SMMC-7721 cells stained for ATG3 (green) using ab233560 (1/200 dilution) in ICC/IF.

    Blue: DRAQ5 fluorescent DNA dye.

    Red: Actin filaments have been labeled with Alexa Fluor®555 phalloidin.

    Secondary antibody: Goat anti-Mouse IgG (H+L) DyLight 488.

  • All lanes : Anti-ATG3 antibody [7A1D1] (ab233560) at 1/500 dilution

    Lane 1 : HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : ATG3 (amino acids 1-100) - hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 36 kDa

  • Anti-ATG3 antibody [7A1D1] (ab233560) at 1/500 dilution + Recombinant human ATG3 protein (amino acids 1-100)

    Predicted band size: 36 kDa



    (Expected MW is 37.3 kDa)

References

ab233560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up