Overview

  • Product name

    Anti-ATG4C antibody [2E10H7]
    See all ATG4C primary antibodies
  • Description

    Mouse monoclonal [2E10H7] to ATG4C
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ATG4C aa 321-458. Expressed in E.coli.
    Sequence:

    GIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSP KKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVN GHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL


    Database link: Q96DT6

  • Positive control

    • WB: Recombinant human ATG4C (aa 321-458) protein; Human ATG4C (aa 321-458)-hIgG-Fc-transfected HEK-293 cell lysate; HEK-293 and MOLT-4 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab233715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 52 kDa.

Target

  • Function

    Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes.
  • Tissue specificity

    Highly expressed in skeletal muscle, heart, liver and testis.
  • Sequence similarities

    Belongs to the peptidase C54 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • APG4 autophagy 4 homolog C (S. cerevisiae) antibody
    • APG4 autophagy 4 homolog C antibody
    • APG4 C antibody
    • APG4-C antibody
    • APG4C antibody
    • ATG 4C antibody
    • ATG4 autophagy related 4 homolog C (S. cerevisiae) antibody
    • ATG4 autophagy related 4 homolog C antibody
    • Atg4c antibody
    • ATG4C_HUMAN antibody
    • AUT (S. cerevisiae) like 1, cysteine endopeptidase antibody
    • AUT like 1, cysteine endopeptidase (S. cerevisiae) antibody
    • AUT like 1, cysteine endopeptidase antibody
    • AUT like 3 cysteine endopeptidase antibody
    • AUT-like 3 cysteine endopeptidase antibody
    • AUTL1 antibody
    • AUTL3 antibody
    • Autophagin 3 antibody
    • Autophagin-3 antibody
    • Autophagy related 4C cysteine peptidase antibody
    • Autophagy related cysteine endopeptidase 3 antibody
    • Autophagy related protein 4 homolog C antibody
    • Autophagy-related cysteine endopeptidase 3 antibody
    • Autophagy-related protein 4 homolog C antibody
    • Cysteine protease ATG4C antibody
    • EC 3.4.22 antibody
    • FLJ14867 antibody
    • OTTHUMP00000010715 antibody
    see all

Images

  • Anti-ATG4C antibody [2E10H7] (ab233715) at 1/500 dilution + Recombinant human ATG4C (aa 321-458) protein

    Developed using the ECL technique.

    Predicted band size: 52 kDa



    Expected MW is 42 kDa.

  • All lanes : Anti-ATG4C antibody [2E10H7] (ab233715) at 1/500 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Human ATG4C (aa 321-458)-hIgG-Fc-transfected HEK-293 cell lysate

    Developed using the ECL technique.

    Predicted band size: 52 kDa

  • All lanes : Anti-ATG4C antibody [2E10H7] (ab233715) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : MOLT-4 (human lymphoblastic leukemia cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 52 kDa

References

ab233715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up