Overview

  • Product name
  • Description
    Rabbit polyclonal to ATMIN
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ATMIN aa 595-768. This sequence corresponds to aa 650-823 of reviewed Uniprot entry O43313.
    Sequence:

    QTEESELSTMTTEPVLESLDIETQTDFLLADTSAQSYGCRGNSNFLGLEM FDTQTQTDLNFFLDSSPHLPLGSILKHSSFSVSTDSSDTETQTEGVSTAK NIPALESKVQLNSTETQTMSSGFETLGSLFFTSNETQTAMDDFLLADLAW NTMESQFSSVETQTSAEPHTVSNF


    Database link: BC002701

  • Positive control
    • WB: Jurkat, HeLa, HepG2, K562 and A549 cell lysates and human fetal kidney tissue lysate. IHC-P: Breast carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab176894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 88 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function
    Plays a crucial role in cell survival and RAD51 foci formation in response to methylating DNA damage. Involved in regulating the activity of ATM in the absence of DNA damage. May play a role in stabilizing ATM.
  • Tissue specificity
    Ubiquitously expressed in normal tissues and cancer cell lines with highest levels in placenta and skeletal muscle.
  • Sequence similarities
    Contains 2 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus. Nuclear, in discrete foci during G1 phase.
  • Information by UniProt
  • Database links
  • Alternative names
    • ASCIZ antibody
    • ATM INteracting protein antibody
    • ATM interactor antibody
    • ATM substrate CHK2-interacting zinc finger protein antibody
    • ATM/ATR substrate CHEK2 interacting zinc finger protein antibody
    • ATM/ATR Substrate Chk2 Interacting Zn++ finger protein antibody
    • ATM/ATR substrate Chk2 interacting Zn2+ finger protein antibody
    • ATM/ATR-substrate CHK2-interacting zinc finger protein antibody
    • ATMIN antibody
    • ATMIN_HUMAN antibody
    • DKFZp779K1455 antibody
    • FLJ76795 antibody
    • KIAA0431 antibody
    • Zinc finger protein 822 antibody
    • ZNF 822 antibody
    • ZNF822 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed paraffin-embedded breast carcinoma tissue labeling ATMIN with ab176894 at 1/100 dilution.

  • All lanes : Anti-ATMIN antibody (ab176894) at 1/500 dilution

    Lane 1 : Jurkat lysate
    Lane 2 : HeLa lysate
    Lane 3 : HepG2 lysate
    Lane 4 : K562 lysate
    Lane 5 : A549 lysate
    Lane 6 : Human fetal kidney tissue lysate

    Developed using the ECL technique.

    Predicted band size: 88 kDa

References

ab176894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up