Overview

  • Product name

    Anti-ATP-binding cassette sub-family A member 3 antibody
    See all ATP-binding cassette sub-family A member 3 primary antibodies
  • Description

    Rabbit polyclonal to ATP-binding cassette sub-family A member 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ATP-binding cassette sub-family A member 3 aa 43-203.
    Sequence:

    RLKIQSENVPNATIYPGQSIQELPLFFTFPPPGDTWELAYIPSHSDAAKT VTETVRRALVINMRVRGFPSEKDFEDYIRYDNCSSSVLAAVVFEHPFNHS KEPLPLAVKYHLRFSYTRRNYMWTQTGSFFLKETEGWHTTSLFPLFPNPG PREPTSPDGGE


    Database link: Q99758

  • Positive control

    • IHC-P: Human lung and testis tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays an important role in the formation of pulmonary surfactant, probably by transporting lipids such as cholesterol.
  • Tissue specificity

    Highly expressed in lung, followed by brain, pancreas, skeletal muscle and heart. Weakly expressed in placenta, kidney and liver. Also expressed in medullary thyroid carcinoma cells (MTC) and in C-cell carcinoma.
  • Involvement in disease

    Defects in ABCA3 are the cause of pulmonary surfactant metabolism dysfunction type 3 (SMDP3) [MIM:610921]; also called pulmonary alveolar proteinosis due to ABCA3 deficiency. A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCA family.
    Contains 2 ABC transporter domains.
  • Domain

    Multifunctional polypeptide with two homologous halves, each containing an hydrophobic membrane-anchoring domain and an ATP binding cassette (ABC) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABC 3 antibody
    • ABC C antibody
    • ABC C transporter antibody
    • ABC transporter 3 antibody
    • ABC-C transporter antibody
    • ABC3 antibody
    • ABCA 3 antibody
    • Abca3 antibody
    • ABCA3 protein antibody
    • ABCA3_HUMAN antibody
    • ABCC antibody
    • ATP binding cassette 3 antibody
    • ATP binding cassette sub family A (ABC1) member 3 antibody
    • ATP binding cassette sub family A member 3 antibody
    • ATP binding cassette transporter 3 antibody
    • ATP-binding cassette 3 antibody
    • ATP-binding cassette sub-family A member 3 antibody
    • ATP-binding cassette transporter 3 antibody
    • CED7. C. elegans, homolog of antibody
    • EST111653 antibody
    • LBM 180 antibody
    • LBM180 antibody
    • MGC72201 antibody
    • P180 Lamellar Body Protein antibody
    • SMDP3 antibody
    see all

Images

  • Paraffin-embedded human lung tissue stained for ATP-binding cassette sub-family A member 3 using ab229761 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for ATP-binding cassette sub-family A member 3 using ab229761 at 1/100 dilution in immunohistochemical analysis.

References

ab229761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up