Overview

  • Product name

  • Description

    Rabbit polyclonal to ATP13A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ATP13A1 aa 134-226.
    Sequence:

    YDPSKATFVKVVPTPNNGSTELVALHRNEGEDGLEVLSFEFQKIKYSYDA LEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNK


    Database link: Q9HD20

  • Positive control

    • Human stomach, lower tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    ATP13A1 belongs to the cation transport ATPase (P type) family. Type V subfamily. There are three named isoforms produced by alternative splicing.
  • Cellular localization

    Membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • ATP13A antibody
    • ATPase type 13A antibody
    • ATPase type 13A1 antibody
    • Cation transporting ATPase antibody
    • CGI 152 antibody
    • CGI152 antibody
    • DKFZp761L1623 antibody
    • FLJ31858 antibody
    • FLJ41786 antibody
    • FLJ43873 antibody
    • FLJ90317 antibody
    • KIAA1825 antibody
    • Probable cation transporting ATPase 13A1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human stomach, lower tissue labeling ATP13A1 with ab185081 at 1/20 dilution.

References

ab185081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up