Overview

  • Product name

  • Description

    Rabbit polyclonal to ATP1B3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse ATP1B3 aa 61-277. (Expressed in E.coli).
    Sequence:

    MLQTLNDEVPKYRDQIPSPGLMVFPKPQTALEYTFSMSEPQTYKKLVEDL ESFLKPYSVEEQKNLTSCPDGAPFIQHGPDYRACQFPVSLLEECSGVTDA NFGYSKGQPCILVKMNRIIDLIPDGYPQISCLPKEENATIATYPEFGVLD LKYFPYYGKKRHVGYRQPLVAVQVKFDSGLNKKEVTVECHIAGTRNLKNK NERDKFLGRVSFKVTAR


    Database link: P97370

  • Positive control

    • WB: Recombinant mouse ATP1B3 protein; Mouse heart lysate. IHC-P: Mouse skeletal muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231671 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231671 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 32 kDa.

Target

  • Function

    This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-3 subunit is not known.
  • Sequence similarities

    Belongs to the X(+)/potassium ATPases subunit beta family.
  • Cellular localization

    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • AT1B3_HUMAN antibody
    • atp1b3 antibody
    • ATPase Na+/K+ transporting beta 3 polypeptide antibody
    • ATPB 3 antibody
    • ATPB-3 antibody
    • ATPB3 antibody
    • CD 298 antibody
    • CD298 antibody
    • CD298 antigen antibody
    • FLJ29027 antibody
    • Na K ATPase beta 3 polypeptide antibody
    • Na+/K+ ATPase beta 3 subunit antibody
    • NKAB3S antibody
    • Sodium potassium ATPase subunit beta 3 (non catalytic) antibody
    • Sodium pump subunit beta 3 antibody
    • Sodium/potassium dependent ATPase beta 3 subunit antibody
    • Sodium/potassium dependent ATPase subunit beta 3 antibody
    • Sodium/potassium transporting ATPase beta 3 chain antibody
    • Sodium/potassium transporting ATPase subunit beta 3 antibody
    • Sodium/potassium-dependent ATPase subunit beta-3 antibody
    • Sodium/potassium-transporting ATPase subunit beta-3 antibody
    see all

Images

  • Anti-ATP1B3 antibody (ab231671) at 2 µg/ml + Recombinant mouse ATP1B3

    Secondary
    HRP-Linked Goat anti-Rabbit IgG at 0.2 µg/ml

    Predicted band size: 32 kDa

  • Anti-ATP1B3 antibody (ab231671) at 2 µg + Mouse heart lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG at 0.2 µg/ml

    Predicted band size: 32 kDa

  • Formalin-fixed, paraffin-embedded mouse skeletal muscle tissue stained for ATP1B3 using ab231671 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse skeletal muscle tissue stained for ATP1B3 using ab231671 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231671 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231671.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up