Overview

  • Product name

  • Description

    Rabbit polyclonal to ATP5C1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ATP5C1 aa 156-266.
    Sequence:

    VGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFS LNTVASADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMT AMDNASKNASE


    Database link: P36542

  • Positive control

    • IHC-P: Human kidney tissue.
  • General notes

     This product was previously labelled as ATPG

     

Properties

Applications

Our Abpromise guarantee covers the use of ab238817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
  • Tissue specificity

    Isoform Heart is expressed specifically in the heart and skeletal muscle, which require rapid energy supply. Isoform Liver is expressed in the brain, liver and kidney. Isoform Heart and Isoform Liver are expressed in the skin, intestine, stomach and aorta.
  • Sequence similarities

    Belongs to the ATPase gamma chain family.
  • Cellular localization

    Mitochondrion. Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP synthase gamma chain, mitochondrial antibody
    • ATP synthase subunit gamma antibody
    • ATP synthase subunit gamma, mitochondrial antibody
    • ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 antibody
    • ATP synthase, H+ transporting, mitochondrial F1 complex, gamma subunit antibody
    • ATP5C 1 antibody
    • ATP5C antibody
    • ATP5C1 antibody
    • ATP5CL1 antibody
    • ATPG_HUMAN antibody
    • F ATPase gamma subunit antibody
    • F-ATPase gamma subunit antibody
    • mitochondrial antibody
    • Mitochondrial ATP synthase, gamma subunit 1 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for ATP5C1 using ab238817 at 1/100 dilution in immunohistochemical analysis.

References

ab238817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up