Overview

  • Product name

  • Description

    Rabbit polyclonal to ATP5G2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human ATP5G2 aa 80-130 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLF C


    Database link: Q06055

  • Positive control

    • Human laryngeal carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.
  • Sequence similarities

    Belongs to the ATPase C chain family.
  • Cellular localization

    Mitochondrion membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AT5G2_HUMAN antibody
    • ATP synthase c subunit antibody
    • ATP synthase F(0) complex subunit C2, mitochondrial antibody
    • ATP synthase H+ transporting mitochondrial F0 complex subunit c subunit 9 isoform 2 antibody
    • ATP synthase H+ transporting mitochondrial F0 complex subunit C2 antibody
    • ATP synthase H+ transporting mitochondrial F0 complex subunit C2 subunit 9 antibody
    • ATP synthase lipid binding protein mitochondrial antibody
    • ATP synthase lipid-binding protein antibody
    • ATP synthase proteolipid P2 antibody
    • ATP synthase proton-transporting mitochondrial F(0) complex subunit C2 antibody
    • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 antibody
    • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 2 antibody
    • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) antibody
    • ATP5A antibody
    • ATP5G2 antibody
    • ATPase protein 9 antibody
    • ATPase subunit c antibody
    • mitochondrial antibody
    • Mitochondrial ATP synthase subunit C subunit 9 isoform 2 antibody
    • Mitochondrial ATP synthase, subunit 9, isoform 2 antibody
    • Mitochondrial ATP synthase, subunit C (subunit 9), isoform 2 antibody
    • Mitochondrial ATP synthase, subunit C, isoform 2 antibody
    • OTTHUMP00000164642 antibody
    • PSEC0033 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human laryngeal carcinoma tissue, labeling ATP5G2 using ab216999 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up